PDB entry 6egf

View 6egf on RCSB PDB site
Description: Crystal structure of the inactive unphosphorylated IRAK4 kinase domain bound to AMP-PNP
Class: signaling protein
Keywords: Kinase, Unphosphorylated, Inactive, SIGNALING PROTEIN
Deposited on 2018-08-19, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NWZ3 (5-301)
      • conflict (152)
    Domains in SCOPe 2.07: d6egfb_
  • Heterogens: ANP, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6egfB (B:)
    gamgsrfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaam
    vditteelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscld
    gtpplswhmrckiaqgaanginflhenhhihrniksanilldeaftakisdfglarasek
    faqtvmtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllld
    ikeeiedeektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemt
    as
    

    Sequence, based on observed residues (ATOM records): (download)
    >6egfB (B:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaamvditt
    eelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtppl
    swhmrckiaqgaanginflhenhhihrniksanilldeaftakisdfglarasekttaym
    apealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeeiedeektiedyid
    kkmndadstsveamysvasqclhekknkrpdikkvqqllqemtas