PDB entry 6egd

View 6egd on RCSB PDB site
Description: Crystal structure of the unphosphorylated IRAK4 kinase domain Bound to a type I inhibitor
Class: transferase/transferase inhibitor
Keywords: Kinase, Unphosphorylated, Inactive, SIGNALING PROTEIN, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-08-19, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NWZ3
      • conflict (152)
    Domains in SCOPe 2.07: d6egda_
  • Chain 'D':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NWZ3 (5-End)
      • expression tag (3-4)
      • conflict (152)
    Domains in SCOPe 2.07: d6egdd1, d6egdd2
  • Heterogens: J87, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6egdA (A:)
    gamgsrfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaam
    vditteelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscld
    gtpplswhmrckiaqgaanginflhenhhihrniksanilldeaftakisdfglarasek
    faqtvmtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllld
    ikeeiedeektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemt
    as
    

    Sequence, based on observed residues (ATOM records): (download)
    >6egdA (A:)
    fhsfsfyelknvtnnfderpisvggnkmgeggvvykgyvnnttvavkklatteelkqqfd
    qeikvmakcqhenlvellgfssdlclvyvympngslldrlscldgtpplswhmrckiaqg
    aanginflhenhhihrniksanilldeaftakisdfglarataymapealrgeitpksdi
    ysfgvvlleiitglpavdehrepqllldikeeiedeektiedyidkkmndadstsveamy
    svasqclhekknkrpdikkvqqllqemt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6egdD (D:)
    gamgsrfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaam
    vditteelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscld
    gtpplswhmrckiaqgaanginflhenhhihrniksanilldeaftakisdfglarasek
    faqtvmtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllld
    ikeeiedeektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemt
    as
    

    Sequence, based on observed residues (ATOM records): (download)
    >6egdD (D:)
    gsrfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklatteel
    kqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtpplswh
    mrckiaqgaanginflhenhhihrniksanilldeaftakisdfglarataymapealrg
    eitpksdiysfgvvlleiitglpavdehrepqllldikeeiedeektiedyidkkmndad
    stsveamysvasqclhekknkrpdikkvqqllqemt