PDB entry 6eg9

View 6eg9 on RCSB PDB site
Description: IRAK4 in complex with Ponatinib
Class: transferase/transferase inhibitor
Keywords: Inhibitor, complex, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-08-19, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eg9a_
  • Chain 'B':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eg9b_
  • Heterogens: 0LI, SO4, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eg9A (A:)
    gamgsenkslevsdtrfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnt
    tvavkklaamvditteelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympng
    slldrlscldgtpplswhmrckiaqgaanginflhenhhihrdiksanilldeaftakis
    dfglarasekfaqtvmtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavd
    ehrepqllldikeeiedeektiedyidkkmndadstsveamysvasqclhekknkrpdik
    kvqqllqemtas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eg9A (A:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaaitteel
    kqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtpplswh
    mrckiaqgaanginflhenhhihrdiksanilldeaftakisdfgvgttaymapealrge
    itpksdiysfgvvlleiitglpavdehrepqllldikeeiedeektiedyidkkmndads
    tsveamysvasqclhekknkrpdikkvqqllqemta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eg9B (B:)
    gamgsenkslevsdtrfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnt
    tvavkklaamvditteelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympng
    slldrlscldgtpplswhmrckiaqgaanginflhenhhihrdiksanilldeaftakis
    dfglarasekfaqtvmtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavd
    ehrepqllldikeeiedeektiedyidkkmndadstsveamysvasqclhekknkrpdik
    kvqqllqemtas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eg9B (B:)
    fhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaaitteelk
    qqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtpplswhm
    rckiaqgaanginflhenhhihrdiksanilldeaftakisdfvgttaymapealrgeit
    pksdiysfgvvlleiitglpavdehrepqllldikeeiedeektiedyidkkmndadsts
    veamysvasqclhekknkrpdikkvqqllqemta