PDB entry 6efu

View 6efu on RCSB PDB site
Description: Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum
Class: hydrolase
Keywords: gh1, hydrolase
Deposited on 2018-08-17, released 2019-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: TRICHODERMA HARZIANUM [TaxId:5544]
    Gene: bgl, CI102_8745
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A127SA86 (1-End)
      • expression tag (0)
      • engineered mutation (167)
      • engineered mutation (172)
    Domains in SCOPe 2.07: d6efua1, d6efua2
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: TRICHODERMA HARZIANUM [TaxId:5544]
    Gene: bgl, CI102_8745
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A127SA86 (1-End)
      • engineered mutation (167)
      • engineered mutation (172)
    Domains in SCOPe 2.07: d6efub_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6efuA (A:)
    hmlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacdsynrtae
    diallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitpfitlfh
    wdlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfnepwcsailgygsgtf
    apgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwdssdpldr
    eaaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfygmnhyts
    nyirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwiskryny
    pkiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgyfawslm
    dnfewadgyvtrfgvtyvdyengqqrfpkksakslkplfdeliake
    

    Sequence, based on observed residues (ATOM records): (download)
    >6efuA (A:)
    hmlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacdsynrtae
    diallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitpfitlfh
    wdlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfnepwcsailgygsgtf
    apgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwdssdpldr
    eaaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfygmnhyts
    nyirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwiskryny
    pkiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgyfawslm
    dnfewadgyvtrfgvtyvdyengqqrfpkksakslkplfdeliak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6efuB (B:)
    hmlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacdsynrtae
    diallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitpfitlfh
    wdlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfnepwcsailgygsgtf
    apgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwdssdpldr
    eaaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfygmnhyts
    nyirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwiskryny
    pkiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgyfawslm
    dnfewadgyvtrfgvtyvdyengqqrfpkksakslkplfdeliake
    

    Sequence, based on observed residues (ATOM records): (download)
    >6efuB (B:)
    mlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacdsynrtaed
    iallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitpfitlfhw
    dlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfnepwcsailgygsgtfa
    pgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwdssdpldre
    aaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfygmnhytsn
    yirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwiskrynyp
    kiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgyfawslmd
    nfewadgyvtrfgvtyvdyengqqrfpkksakslkplfdeliak