PDB entry 6efk

View 6efk on RCSB PDB site
Description: crystal structure of the human chip tpr domain in complex with a 5mer acetylated hsp70 peptide
Deposited on 2018-08-16, released 2019-07-31
The last revision was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase CHIP
    Species: Homo sapiens [TaxId:9606]
    Gene: STUB1, CHIP, PP1131
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase CHIP
    Species: Homo sapiens [TaxId:9606]
    Gene: STUB1, CHIP, PP1131
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ace-ile-glu-glu-val-asp
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EFK (Start-4)
  • Chain 'D':
    Compound: ace-ile-glu-glu-val-asp
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EFK (Start-4)
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6efkA (A:)
spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqheqalad
crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
kkkrwnsieerr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6efkB (B:)
spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqheqalad
crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
kkkrwnsieerr

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6efkC (C:)
ieevd

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6efkD (D:)
ieevd