PDB entry 6eey

View 6eey on RCSB PDB site
Description: crystal structure of human scribble pdz4 r1110g mutant
Deposited on 2018-08-15, released 2019-10-02
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein scribble homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: SCRIB, CRIB1, KIAA0147, LAP4, SCRB1, VARTUL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14160 (3-94)
      • expression tag (1-2)
      • engineered mutation (15)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6eeyA (A:)
    shmlrelciqkapgeglgisirggarghagnprdptdegifiskvsptgaagrdgrlrvg
    lrllevnqqsllglthgeavqllrsvgdtltvlvc
    

    Sequence, based on observed residues (ATOM records):
    >6eeyA (A:)
    hmlrelciqkapgeglgisirggarghagnprdptdegifiskvsptgaagrdgrlrvgl
    rllevnqqsllglthgeavqllrsvgdtltvlvc