PDB entry 6eek

View 6eek on RCSB PDB site
Description: Crystal structure of apo Staphylcoccal nuclease variant Delta+PHS T62E/V66K, pH 7 at cryogenic temperature
Class: hydrolase
Keywords: nuclease, hyperstable, hydrolase, ionizable group
Deposited on 2018-08-14, released 2018-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (43-44)
      • engineered mutation (55)
      • engineered mutation (59)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.08: d6eeka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6eekA (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafekkmk
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >6eekA (A:)
lhkepatllmykgqpmtfrlllvdtpefnekygpeasafekkmkenakkievefdkgqrt
dkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqakkeklniws