PDB entry 6eei

View 6eei on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana phenylacetaldehyde synthase in complex with L-phenylalanine
Class: lyase
Keywords: Aromatic Amino Acid Decarboxylase, LYASE
Deposited on 2018-08-14, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine decarboxylase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ELI5, At2g20340, F11A3.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eeia_
  • Chain 'B':
    Compound: Tyrosine decarboxylase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ELI5, At2g20340, F11A3.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eeib_
  • Heterogens: SO4, PHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eeiA (A:)
    mengsgkvlkpmdseqlreyghlmvdfiadyyktiedfpvlsqvqpgylhkllpdsapdh
    petldqvlddvrakilpgvthwqspsffayypsnssvagflgemlsaglgivgfswvtsp
    aatelemivldwvakllnlpeqfmskgngggviqgsaseavlvvliaardkvlrsvgkna
    leklvvyssdqthsalqkacqiagihpencrvlttdsstnyalrpeslqeavsrdleagl
    ipfflcanvgttsstavdplaalgkiansngiwfhvdaayagsacicpeyrqyidgveta
    dsfnmnahkwfltnfdcsllwvkdqdsltlalstnpeflknkasqanlvvdykdwqiplg
    rrfrslklwmvlrlygsetlksyirnhiklakefeqlvsqdpnfeivtprifalvcfrlv
    pvkdeekkcnnrnrelldavnssgklfmshtalsgkivlrcaigaplteekhvkeawkii
    qeeasyllhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eeiA (A:)
    vlkpmdseqlreyghlmvdfiadyyktiedfpvlsqvqpgylhkllpdsapdhpetldqv
    lddvrakilpgvthwqspsffayypsnssvagflgemlsaglgivgfswvtspaatelem
    ivldwvakllnlpeqfmskgngggviqgsaseavlvvliaardkvlrsvgknaleklvvy
    ssdqthsalqkacqiagihpencrvlttdsstnyalrpeslqeavsrdleaglipfflca
    nvgttsstavdplaalgkiansngiwfhvdaayagsacicpeyrqyidgvetadsfnmna
    hkwfltnfdcsllwvkdqdsltlalstnplvvdykdwqiplgrrfrslklwmvlrlygse
    tlksyirnhiklakefeqlvsqdpnfeivtprifalvcfrlvpvkcnnrnrelldavnss
    gklfmshtalsgkivlrcaigaplteekhvkeawkiiqeeasyllh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eeiB (B:)
    mengsgkvlkpmdseqlreyghlmvdfiadyyktiedfpvlsqvqpgylhkllpdsapdh
    petldqvlddvrakilpgvthwqspsffayypsnssvagflgemlsaglgivgfswvtsp
    aatelemivldwvakllnlpeqfmskgngggviqgsaseavlvvliaardkvlrsvgkna
    leklvvyssdqthsalqkacqiagihpencrvlttdsstnyalrpeslqeavsrdleagl
    ipfflcanvgttsstavdplaalgkiansngiwfhvdaayagsacicpeyrqyidgveta
    dsfnmnahkwfltnfdcsllwvkdqdsltlalstnpeflknkasqanlvvdykdwqiplg
    rrfrslklwmvlrlygsetlksyirnhiklakefeqlvsqdpnfeivtprifalvcfrlv
    pvkdeekkcnnrnrelldavnssgklfmshtalsgkivlrcaigaplteekhvkeawkii
    qeeasyllhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eeiB (B:)
    vlkpmdseqlreyghlmvdfiadyyktiedfpvlsqvqpgylhkllpdsapdhpetldqv
    lddvrakilpgvthwqspsffayypsnssvagflgemlsaglgivgfswvtspaatelem
    ivldwvakllnlpeqfmskgngggviqgsaseavlvvliaardkvlrsvgknaleklvvy
    ssdqthsalqkacqiagihpencrvlttdsstnyalrpeslqeavsrdleaglipfflca
    nvgttsstavdplaalgkiansngiwfhvdaayagsacicpeyrqyidgvetadsfnmna
    hkwfltnfdcsllwvkdqdsltlalstnpefllvvdykdwqiplgrrfrslklwmvlrly
    gsetlksyirnhiklakefeqlvsqdpnfeivtprifalvcfrlvpvkdecnnrnrelld
    avnssgklfmshtalsgkivlrcaigaplteekhvkeawkiiqeeasyllh