PDB entry 6eea

View 6eea on RCSB PDB site
Description: Bioreductive 4-hydroxy-3-nitro-5-ureido-benzenesulfonamides selectively target the tumor-associated carbonic anhydrase isoforms IX and XII and show hypoxia-enhanced cytotoxicity against human cancer cell lines.
Class: LYASE/LYASE inhibitor
Keywords: Hypoxia, carbonic anhydrase IX, carbonic anhydrase XII, inhibition, anti-proliferative., LYASE, LYASE-LYASE inhibitor complex
Deposited on 2018-08-13, released 2018-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (0-256)
      • engineered mutation (61)
      • engineered mutation (63)
      • engineered mutation (65)
      • engineered mutation (87)
      • engineered mutation (126)
      • engineered mutation (165)
      • engineered mutation (199)
    Domains in SCOPe 2.08: d6eeaa_
  • Heterogens: J3V, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eeaA (A:)
    hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
    hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
    ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
    lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
    wrpaqplknrqikasfk