PDB entry 6ee7

View 6ee7 on RCSB PDB site
Description: Small tetraheme cytochrome c from Shewanella oneidensis
Class: electron transport
Keywords: electron transfer, ELECTRON TRANSPORT
Deposited on 2018-08-13, released 2019-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-06-24, with a file datestamp of 2020-06-19.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Periplasmic tetraheme cytochrome c CctA
  Species: Shewanella oneidensis (strain MR-1) [TaxId:211586]
  Gene: cctA, SO_2727
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8EDL6 (0-90)
  Domains in SCOPe 2.08: d6ee7a_
• Heterogens: HEC, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ee7A (A:)
  adqklsdfhaesggceschkdgtpsadgafefaqcqschgklsemdavhkphdgnlvcad
  chavhdmnvgqkptceschddgrtsasvlkk