PDB entry 6edz

View 6edz on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis icl2 in complex with acetyl-coa, form i
Deposited on 2018-08-12, released 2019-08-14
The last revision was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isocitrate lyase 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: icl2, aceA-2, MT1966
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Isocitrate lyase 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: icl2, aceA-2, MT1966
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Isocitrate lyase 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: icl2, aceA-2, MT1966
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Isocitrate lyase 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: icl2, aceA-2, MT1966
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6edzA (A:)
    mgsshhhhhhssglvprgshmaiaetdtevhtpfeqdfekdvaatqryfdssrfagiirl
    ytarqvveqrgtipvdhivareaagafyerlrelfaarksittfgpyspgqavsmkrmgi
    eaiylggwatsakgsstedpgpdlasyplsqvpddaavlvralltadrnqhylrlqmser
    qraatpaydfrpfiiadadtghggdphvrnlirrfvevgvpgyhiedqrpgtkkcghqgg
    kvlvpsdeqikrlnaarfqldimrvpgiivartdaeaanlidsraderdqpfllgatkld
    vpsykscflamvrrfyelgvkelnghllyalgdseyaaaggwlerqgifglvsdavnawr
    edgqqsidgifdqvesrfvaaweddaglmtygeavadvlefgqsegepigmapeewrafa
    araslhaarakakelgadppwdcelaktpegyyqirggipyaiakslaaapfadilwmet
    ktadladarqfaeaihaefpdqmlaynlspsfnwdttgmtdeemrrfpeelgkmgfvfnf
    itygghqidgvaaeefatalrqdgmlalarlqrkmrlvespyrtpqtlvggprsdaalaa
    ssgrtattkamgkgstqhqhlvqtevprklleewlamwsghyqlkdklrvqlrpqragse
    vlelgihgesddklanvifqpiqdrrgrtillvrdqntfgaelrqkrlmtlihlwlvhrf
    kaqavhyvtptddnlyqtskmkshgiftevnqevgeiivaevnhpriaelltpdrvalrk
    litkea
    

    Sequence, based on observed residues (ATOM records):
    >6edzA (A:)
    tpfeqdfekdvaatqryfdssrfagiirlytarqvveqrgtipvdhivareaagafyerl
    relfaarksittfgpyspgqavsmkrmgieaiylggwatsakgsstedpgpdlasyplsq
    vpddaavlvralltadrnqhylrlqmserqraatpaydfrpfiiadadtghggdphvrnl
    irrfvevgvpgyhiedqrpgtkkcghqggkvlvpsdeqikrlnaarfqldimrvpgiiva
    rtdaeaanlidsraderdqpfllgatkldvpsykscflamvrrfyelgvkelnghllyal
    gdseyaaaggwlerqgifglvsdavnawredgqqsidgifdqvesrfvaaweddaglmty
    geavadvleapeewrafaaraslhaarakakelgadppwdcelaktpegyyqirggipya
    iakslaaapfadilwmetktadladarqfaeaihaefpdqmlaynlspsfnwdttgmtde
    emrrfpeelgkmgfvfnfitygghqidgvaaeefatalrqdgmlalarlqrkmrlvespy
    rtpqtlvggprsdaalaassgrtattkalvqtevprklleewlamwsghyqlkdklrvql
    rpqragsevlelgihgesddklanvifqpiqdrrgrtillvrdqntfgaelrqkrlmtli
    hlwlvhrfkaqavhyvtptddnlyqtskmkshgiftevnqevgeiivaevnhpriaellt
    pdrvalrklitke
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6edzB (B:)
    mgsshhhhhhssglvprgshmaiaetdtevhtpfeqdfekdvaatqryfdssrfagiirl
    ytarqvveqrgtipvdhivareaagafyerlrelfaarksittfgpyspgqavsmkrmgi
    eaiylggwatsakgsstedpgpdlasyplsqvpddaavlvralltadrnqhylrlqmser
    qraatpaydfrpfiiadadtghggdphvrnlirrfvevgvpgyhiedqrpgtkkcghqgg
    kvlvpsdeqikrlnaarfqldimrvpgiivartdaeaanlidsraderdqpfllgatkld
    vpsykscflamvrrfyelgvkelnghllyalgdseyaaaggwlerqgifglvsdavnawr
    edgqqsidgifdqvesrfvaaweddaglmtygeavadvlefgqsegepigmapeewrafa
    araslhaarakakelgadppwdcelaktpegyyqirggipyaiakslaaapfadilwmet
    ktadladarqfaeaihaefpdqmlaynlspsfnwdttgmtdeemrrfpeelgkmgfvfnf
    itygghqidgvaaeefatalrqdgmlalarlqrkmrlvespyrtpqtlvggprsdaalaa
    ssgrtattkamgkgstqhqhlvqtevprklleewlamwsghyqlkdklrvqlrpqragse
    vlelgihgesddklanvifqpiqdrrgrtillvrdqntfgaelrqkrlmtlihlwlvhrf
    kaqavhyvtptddnlyqtskmkshgiftevnqevgeiivaevnhpriaelltpdrvalrk
    litkea
    

    Sequence, based on observed residues (ATOM records):
    >6edzB (B:)
    htpfeqdfekdvaatqryfdssrfagiirlytarqvveqrgtipvdhivareaagafyer
    lrelfaarksittfgpyspgqavsmkrmgieaiylggwatsakgsstedpgpdlasypls
    qvpddaavlvralltadrnqhylrlqmserqraatpaydfrpfiiadadtghggdphvrn
    lirrfvevgvpgyhiedqrpgtkkqggkvlvpsdeqikrlnaarfqldimrvpgiivart
    daeaanlidsraderdqpfllgatkldvpsykscflamvrrfyelgvkelnghllyalgd
    seyaaaggwlerqgifglvsdavnawredgqqdgifdqvesrfvaaweddaglmtygeav
    advlefgapeewrafaaraslhaarakakelgadppwdcelaktpegyyqirggipyaia
    kslaaapfadilwmetktadladarqfaeaihaefpdqmlaynlspsfnwdttgmtdeem
    rrfpeelgkmgfvfnfitygghqidgvaaeefatalrqdgmlalarlqrkmrlvespyrt
    pqtlvggprsdaalaassgrtattkamqtevprklleewlamwsghyqlkdklrvqlrpq
    ragsevlelgihgesddklanvifqpiqdrrgrtillvrdqntfgaelrqkrlmtlihlw
    lvhrfkaqavhyvtptddnlyqtskmkshgiftevnqevgeiivaevnhpriaelltpdr
    valrklitke
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6edzC (C:)
    mgsshhhhhhssglvprgshmaiaetdtevhtpfeqdfekdvaatqryfdssrfagiirl
    ytarqvveqrgtipvdhivareaagafyerlrelfaarksittfgpyspgqavsmkrmgi
    eaiylggwatsakgsstedpgpdlasyplsqvpddaavlvralltadrnqhylrlqmser
    qraatpaydfrpfiiadadtghggdphvrnlirrfvevgvpgyhiedqrpgtkkcghqgg
    kvlvpsdeqikrlnaarfqldimrvpgiivartdaeaanlidsraderdqpfllgatkld
    vpsykscflamvrrfyelgvkelnghllyalgdseyaaaggwlerqgifglvsdavnawr
    edgqqsidgifdqvesrfvaaweddaglmtygeavadvlefgqsegepigmapeewrafa
    araslhaarakakelgadppwdcelaktpegyyqirggipyaiakslaaapfadilwmet
    ktadladarqfaeaihaefpdqmlaynlspsfnwdttgmtdeemrrfpeelgkmgfvfnf
    itygghqidgvaaeefatalrqdgmlalarlqrkmrlvespyrtpqtlvggprsdaalaa
    ssgrtattkamgkgstqhqhlvqtevprklleewlamwsghyqlkdklrvqlrpqragse
    vlelgihgesddklanvifqpiqdrrgrtillvrdqntfgaelrqkrlmtlihlwlvhrf
    kaqavhyvtptddnlyqtskmkshgiftevnqevgeiivaevnhpriaelltpdrvalrk
    litkea
    

    Sequence, based on observed residues (ATOM records):
    >6edzC (C:)
    htpfeqdfekdvaatqryfdssrfagiirlytarqvveqrgtipvdhivareaagafyer
    lrelfaarksittfgpyspgqavsmkrmgieaiylggwatsakgsstedpgpdlasypls
    qvpddaavlvralltadrnqhylrlqmserqraatpaydfrpfiiadadtghggdphvrn
    lirrfvevgvpgyhiedqrpgtkgkvlvpsdeqikrlnaarfqldimrvpgiivartdae
    aanlidsraderdqpfllgavpsykscflamvrrfyelgvkelnghllyalgdseyaaag
    gwlerqgifglvsdavnawredgqqsidgifdqvesrfvaaweddaglmtygeavadvma
    peewrafaaraslhaarakakelgadppwdcelaktpegyyqirggipyaiakslaaapf
    adilwmetktadladarqfaeaihaefpdqmlaynlspsfnwdttgmtdeemrrfpeelg
    kmgfvfnfitygghqidgvaaeefatalrqdgmlalarlqrkmrlvespyrtpqtlvggp
    rsdaalaassgrtattkamgvqtevprklleewlamwsghyqlkdklrvqlrpqragsev
    lelgihgesddklanvifqpiqdrrgrtillvrdqntfgaelrqkrlmtlihlwlvhrfk
    aqavhyvtptddnlyqtskmkshgiftevnqevgeiivaevnhpriaelltpdrvalrkl
    itk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6edzD (D:)
    mgsshhhhhhssglvprgshmaiaetdtevhtpfeqdfekdvaatqryfdssrfagiirl
    ytarqvveqrgtipvdhivareaagafyerlrelfaarksittfgpyspgqavsmkrmgi
    eaiylggwatsakgsstedpgpdlasyplsqvpddaavlvralltadrnqhylrlqmser
    qraatpaydfrpfiiadadtghggdphvrnlirrfvevgvpgyhiedqrpgtkkcghqgg
    kvlvpsdeqikrlnaarfqldimrvpgiivartdaeaanlidsraderdqpfllgatkld
    vpsykscflamvrrfyelgvkelnghllyalgdseyaaaggwlerqgifglvsdavnawr
    edgqqsidgifdqvesrfvaaweddaglmtygeavadvlefgqsegepigmapeewrafa
    araslhaarakakelgadppwdcelaktpegyyqirggipyaiakslaaapfadilwmet
    ktadladarqfaeaihaefpdqmlaynlspsfnwdttgmtdeemrrfpeelgkmgfvfnf
    itygghqidgvaaeefatalrqdgmlalarlqrkmrlvespyrtpqtlvggprsdaalaa
    ssgrtattkamgkgstqhqhlvqtevprklleewlamwsghyqlkdklrvqlrpqragse
    vlelgihgesddklanvifqpiqdrrgrtillvrdqntfgaelrqkrlmtlihlwlvhrf
    kaqavhyvtptddnlyqtskmkshgiftevnqevgeiivaevnhpriaelltpdrvalrk
    litkea
    

    Sequence, based on observed residues (ATOM records):
    >6edzD (D:)
    htpfeqdfekdvaatqryfdssrfagiirlytarqvveqrgtipvdhivareaagafyer
    lrelfaarksittfgpyspgqavsmkrmgieaiylggwatsakgsstedpgpdlasypls
    qvpddaavlvralltadrnqhylrlqmserqraatpaydfrpfiiadadtghggdphvrn
    lirrfvevgvpgyhiedqrpgtkkhqggkvlvpsdeqikrlnaarfqldimrvpgiivar
    tdaeaanlidsraderdqpfllgatkldvpsykscflamvrrfyelgvkelnghllyalg
    dseyaaaggwlerqgifglvsdavnawredgqqsidgifdqvesrfvaaweddaglmtyg
    eavadvleapeewrafaaraslhaarakakelgadppwdcelaktpegyyqirggipyai
    akslaaapfadilwmetktadladarqfaeaihaefpdqmlaynlspsfnwdttgmtdee
    mrrfpeelgkmgfvfnfitygghqidgvaaeefatalrqdgmlalarlqrkmrlvespyr
    tpqtlvggprsdaalaassgrtattkamgvqtevprklleewlamwsghyqlkdklrvql
    rpqragsevlelgihgesddklanvifqpiqdrrgrtillvrdqntfgaelrqkrlmtli
    hlwlvhrfkaqavhyvtptddnlyqtskmkshgiftevnqevgeiivaevnhpriaellt
    pdrvalrklitke