PDB entry 6edm

View 6edm on RCSB PDB site
Description: Structure of apo-CDD-1 beta-lactamase
Class: hydrolase
Keywords: beta-lactamase, class D, apo protein, ANTIMICROBIAL PROTEIN, HYDROLASE
Deposited on 2018-08-09, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Clostridioides difficile [TaxId:1496]
    Gene: blaR1_1, BGU81_18485, SAMEA3374989_01677
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A160YKM3 (1-250)
      • expression tag (0)
      • conflict (179)
      • conflict (185)
    Domains in SCOPe 2.07: d6edma1, d6edma2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6edmA (A:)
    avnivdysdcfegisggaifcntknkeyniynkelietrrspcstfkivstliglekgvi
    nskesvmgydgtdypnknwnknlsleeafkescvwyykklinkvdaksvqnilddlkygn
    cdisewegdlkngkghlngfwlesslqispkeqvqtmakifegdtnfkkehinilrdima
    idvndaninvygktgtgfdeknkrvdawfvgmleregdtyyfaiksddsnkeitgpkvke
    iainiikkyys