PDB entry 6edi

View 6edi on RCSB PDB site
Description: crystal structure of leishmania braziliensis glucokinase
Deposited on 2018-08-09, released 2018-08-29
The last revision was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucokinase
    Species: Leishmania braziliensis MHOM/BR/75/M2904 [TaxId:420245]
    Gene: LBRM_35_2550
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Glucokinase
    Species: Leishmania braziliensis MHOM/BR/75/M2904 [TaxId:420245]
    Gene: LBRM_35_2550
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ediA (A:)
    mgrgshhhhhhgmamvqtkeialeqlaltltgdaswssgpiyvvcdvggtsarvgfsqas
    qhdrsglhiiyvrfkvtksdirqlleffdevlqhlkknlpdhgasflrrvasgavsvpgp
    vtngqlagpfnnlkgiarlvdypvelfpkgrsallndleagaygvlalsnagilsdyfkv
    mwkgtqwdalsegkpagstigrgrcmvvapgtgvgsslihyvgvsdsyivlalecgslsm
    swcanedskyvqalagymaskahakgldstvapiweaasngaglefnyayakegqkasap
    lksapevaklaksgsdtaaiaavdrlyknligltaettmqflpltcvlmgdnvvansfyf
    ekpenvkrlqarlhehamerqfkflsrttflrqvssvninllgclgfgsqls
    

    Sequence, based on observed residues (ATOM records):
    >6ediA (A:)
    mvqtkeialeqlaltltgdaswssgpiyvvcdvggtsarvgfsqasqhdrsglhiiyvrf
    kvtksdirqlleffdevlqhlkknlpdhgasflrrvasgavsvpgpvtngqlagpfnnlk
    giarlvdypvelfpkgrsallndleagaygvlalsnagilsdyfkvmwkgtqwdalsegk
    pagstigrgrcmvvapgtgvgsslihyvgvsdsyivlalecgslsmswcanedskyvqal
    agymaskgldstvapiweaasngaglefnyayakegqkasaplksapevaklaksgsdta
    aiaavdrlyknligltaettmqflpltcvlmgdnvvansfyfekpenvkrlqarlheham
    erqfkflsrttflrqvssvninllgclgfgsqls
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ediB (B:)
    mgrgshhhhhhgmamvqtkeialeqlaltltgdaswssgpiyvvcdvggtsarvgfsqas
    qhdrsglhiiyvrfkvtksdirqlleffdevlqhlkknlpdhgasflrrvasgavsvpgp
    vtngqlagpfnnlkgiarlvdypvelfpkgrsallndleagaygvlalsnagilsdyfkv
    mwkgtqwdalsegkpagstigrgrcmvvapgtgvgsslihyvgvsdsyivlalecgslsm
    swcanedskyvqalagymaskahakgldstvapiweaasngaglefnyayakegqkasap
    lksapevaklaksgsdtaaiaavdrlyknligltaettmqflpltcvlmgdnvvansfyf
    ekpenvkrlqarlhehamerqfkflsrttflrqvssvninllgclgfgsqls
    

    Sequence, based on observed residues (ATOM records):
    >6ediB (B:)
    mvqtkeialeqlaltltgdaswssgpiyvvcdvggtsarvgfsqasqhdrsglhiiyvrf
    kvtksdirqlleffdevlqhlkknlpdhgasflrrvasgavsvpgpvtngqlagpfnnlk
    giarlvdypvelfpkgrsallndleagaygvlalsnagilsdyfkvmwkgtqwdalsegk
    pagstigrgrcmvvapgtgvgsslihyvgvsdsyivlalecgslsmswcanedskyvqal
    agymaskgldstvapiweaasngaglefnyayakegqkasaplksapevaklaksgsdta
    aiaavdrlyknligltaettmqflpltcvlmgdnvvansfyfekpenvkrlqarlheham
    erqfkflsrttflrqvssvninllgclgfgsqls