PDB entry 6edh

View 6edh on RCSB PDB site
Description: Taurine:2OG dioxygenase (TauD) bound to the vanadyl ion, taurine, and succinate
Class: oxidoreductase
Keywords: hydroxylase, 2-oxo-glutarate, vanadyl ion, oxidoreductase
Deposited on 2018-08-09, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-Ketoglutarate-Dependent Taurine Dioxygenase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: tauD, ssiD, yaiG, b0368, JW0360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6edha_
  • Chain 'B':
    Compound: Alpha-Ketoglutarate-Dependent Taurine Dioxygenase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: tauD, ssiD, yaiG, b0368, JW0360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6edhb_
  • Heterogens: ACT, VVO, SIN, TAU, 1PE, PEG, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6edhA (A:)
    mserlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqral
    aqrfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelp
    stggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavak
    nppllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrw
    qpndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyrag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6edhA (A:)
    erlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaq
    rfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpst
    ggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavaknp
    pllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqp
    ndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyrag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6edhB (B:)
    mserlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqral
    aqrfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelp
    stggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavak
    nppllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrw
    qpndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyrag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6edhB (B:)
    erlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaq
    rfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpst
    ggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavaknp
    pllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqp
    ndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyrag