PDB entry 6ed0

View 6ed0 on RCSB PDB site
Description: OhrA (Organic Hydroperoxide Resistance protein) mutant (C61S) in the "open conformation" from chromobacterium violaceum
Class: oxidoreductase
Keywords: Ohr, thiol-proxidase, OXIDOREDUCTASE
Deposited on 2018-08-08, released 2020-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum ATCC 12472 [TaxId:243365]
    Gene: ohr2, CV_0209
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7P1K4 (20-161)
      • expression tag (12-19)
      • engineered mutation (80)
    Domains in SCOPe 2.07: d6ed0a1, d6ed0a2
  • Chain 'B':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum ATCC 12472 [TaxId:243365]
    Gene: ohr2, CV_0209
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7P1K4 (20-161)
      • engineered mutation (80)
    Domains in SCOPe 2.07: d6ed0b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ed0A (A:)
    mgsshhhhhhssglvprgshmnplqkvlytaeatatggrdgraessdgalqvklstprel
    gglggdgtnpeqlfaagysasfigalkvaaqqagvrlpaevsvtgkvsigpiahgfgiaa
    klavslpglerdaglrlieaahgicpysnatrgnieveltla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ed0A (A:)
    glvprgshmnplqkvlytaeatatggrdgraessdgalqvklstprelgglggdgtnpeq
    lfaagysasfigalkvaaqqagvrlpaevsvtgkvsigpiahgfgiaaklavslpglerd
    aglrlieaahgicpysnatrgnieveltla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ed0B (B:)
    mgsshhhhhhssglvprgshmnplqkvlytaeatatggrdgraessdgalqvklstprel
    gglggdgtnpeqlfaagysasfigalkvaaqqagvrlpaevsvtgkvsigpiahgfgiaa
    klavslpglerdaglrlieaahgicpysnatrgnieveltla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ed0B (B:)
    mnplqkvlytaeatatggrdgraessdgalqvklstprelgglggdgtnpeqlfaagysa
    sfigalkvaaqqagvrlpaevsvtgkvsigpiahgfgiaaklavslpglerdaglrliea
    ahgicpysnatrgnieveltla