PDB entry 6ecy

View 6ecy on RCSB PDB site
Description: OhrA (Organic Hydroperoxide Resistance protein) wild type from chromobacterium violaceum
Class: oxidoreductase
Keywords: Ohr, thiol-proxidase, OXIDOREDUCTASE
Deposited on 2018-08-08, released 2020-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum ATCC 12472 [TaxId:243365]
    Gene: ohr2, CV_0209
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7P1K4 (20-161)
      • expression tag (19)
    Domains in SCOPe 2.07: d6ecya1, d6ecya2
  • Chain 'B':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum ATCC 12472 [TaxId:243365]
    Gene: ohr2, CV_0209
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7P1K4 (20-161)
      • expression tag (7-19)
    Domains in SCOPe 2.07: d6ecyb1, d6ecyb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ecyA (A:)
    mgsshhhhhhssglvprgshmnplqkvlytaeatatggrdgraessdgalqvklstprel
    gglggdgtnpeqlfaagysacfigalkvaaqqagvrlpaevsvtgkvsigpiahgfgiaa
    klavslpglerdaglrlieaahgicpysnatrgnieveltla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ecyA (A:)
    hmnplqkvlytaeatatggrdgraessdgalqvklstprelgglggdgtnpeqlfaagys
    acfigalkvaaqqagvrlpaevsvtgkvsigpiahgfgiaaklavslpglerdaglrlie
    aahgicpysnatrgnieveltla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ecyB (B:)
    mgsshhhhhhssglvprgshmnplqkvlytaeatatggrdgraessdgalqvklstprel
    gglggdgtnpeqlfaagysacfigalkvaaqqagvrlpaevsvtgkvsigpiahgfgiaa
    klavslpglerdaglrlieaahgicpysnatrgnieveltla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ecyB (B:)
    hhhssglvprgshmnplqkvlytaeatatggrdgraessdgalqvklstprelgglggdg
    tnpeqlfaagysacfigalkvaaqqagvrlpaevsvtgkvsigpiahgfgiaaklavslp
    glerdaglrlieaahgicpysnatrgnieveltla