PDB entry 6ecs

View 6ecs on RCSB PDB site
Description: Crystal structure of WHV core protein mutant Y132A dimer
Class: viral protein
Keywords: WHV, Core protein dimer, VIRAL PROTEIN
Deposited on 2018-08-08, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: External core antigen
    Species: Woodchuck hepatitis B virus [TaxId:35269]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6J2 (0-End)
      • engineered mutation (131)
    Domains in SCOPe 2.07: d6ecsa_
  • Chain 'B':
    Compound: External core antigen
    Species: Woodchuck hepatitis B virus [TaxId:35269]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6J2 (0-End)
      • engineered mutation (131)
    Domains in SCOPe 2.07: d6ecsb_
  • Chain 'C':
    Compound: External core antigen
    Species: Woodchuck hepatitis B virus [TaxId:35269]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ecsc_
  • Chain 'D':
    Compound: External core antigen
    Species: Woodchuck hepatitis B virus [TaxId:35269]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ecsd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ecsA (A:)
    mdidpykefgssyqllnflpldffpdlnalvdtatalyeeeltgrehcsphhtairqalv
    cwdeltkliawmssnitseqvrtiivnhvndtwglkvrqslwfhlscltfgqhtvqeflv
    sfgvwirtpaparppnapilstlpehtvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ecsA (A:)
    mdidpykefgssyqllnflpldffpdlnalvdtatalyeeeltgrehcsphhtairqalv
    cwdeltkliawmssnitseqvrtiivnhvndtwglkvrqslwfhlscltfgqhtvqeflv
    sfgvwirtpaparppnapilstlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ecsB (B:)
    mdidpykefgssyqllnflpldffpdlnalvdtatalyeeeltgrehcsphhtairqalv
    cwdeltkliawmssnitseqvrtiivnhvndtwglkvrqslwfhlscltfgqhtvqeflv
    sfgvwirtpaparppnapilstlpehtvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ecsB (B:)
    mdidpykefgssyqllnflpldffpdlnalvdtatalyeeeltgrehcsphhtairqalv
    cwdeltkliawmssnitseqvrtiivnhvndtwglkvrqslwfhlscltfgqhtvqeflv
    sfgvwirtpaparppnapils
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ecsC (C:)
    mdidpykefgssyqllnflpldffpdlnalvdtatalyeeeltgrehcsphhtairqalv
    cwdeltkliawmssnitseqvrtiivnhvndtwglkvrqslwfhlscltfgqhtvqeflv
    sfgvwirtpaparppnapilstlpehtvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ecsC (C:)
    mdidpykefgssyqllnflpldffpdlnalvdtatalyeeeltgrehcsphhtairqalv
    cwdeltkliawmssnitseqvrtiivnhvndtwglkvrqslwfhlscltfgqhtvqeflv
    sfgvwapils
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ecsD (D:)
    mdidpykefgssyqllnflpldffpdlnalvdtatalyeeeltgrehcsphhtairqalv
    cwdeltkliawmssnitseqvrtiivnhvndtwglkvrqslwfhlscltfgqhtvqeflv
    sfgvwirtpaparppnapilstlpehtvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ecsD (D:)
    mdidpykefgssyqllnflpldffpdlnalvdtatalyeeeltgrehcsphhtairqalv
    cwdeltkliawmssnitseqvrtiivnhvndtwglkvrqslwfhlscltfgqhtvqeflv
    sfgvwpi