PDB entry 6ecl

View 6ecl on RCSB PDB site
Description: Crystal Structure of a 1,2,4-Triazole Allosteric RNase H Inhibitor in Complex with HIV Reverse Transcriptase
Class: transferase
Keywords: hiv-1, reverse transcriptase, RNAse h, inhibitor, transferase
Deposited on 2018-08-08, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Reverse transcriptase/ribonuclease H
    Species: Human immunodeficiency virus type 1 group M subtype B (isolate BH10) [TaxId:11678]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (2-End)
      • initiating methionine (0)
      • expression tag (1)
      • engineered mutation (281)
    Domains in SCOPe 2.07: d6ecla1, d6ecla2
  • Chain 'B':
    Compound: Reverse transcriptase/ribonuclease H
    Species: Human immunodeficiency virus type 1 group M subtype B (isolate BH10) [TaxId:11678]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (Start-428)
      • engineered mutation (280)
    Domains in SCOPe 2.07: d6eclb_
  • Heterogens: MN, T90, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eclA (A:)
    mvpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpynt
    pvfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsv
    pldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdi
    viyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdk
    wtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkaltevipltee
    aelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmr
    gahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvn
    tpplvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqkte
    lqaiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpa
    hkgiggneqvdklvsag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eclA (A:)
    mvpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpynt
    pvfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsv
    pldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdi
    viyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdk
    wtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkaltevipltee
    aelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmr
    gahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvn
    tpplvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqkte
    lqaiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpa
    hkgiggneqvdklvsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eclB (B:)
    gpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntp
    vfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvp
    ldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiv
    iyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkw
    tvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteea
    elelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrg
    ahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvnt
    pplvklwyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eclB (B:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwiphpaglkkkksvtvldvgdayfsvpldedfrkyta
    ftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqymddlyv
    gsdleigqhrtkieelrqhllrwlwmgyelhpdkwtvqpivlpekdswtvndiqklvgkl
    nwasqiypgikvrqlskllrgtkalteviplteeaelelaenreilkepvhgvyydpskd
    liaeiqkqgqgqwtyqiyqepfknlktgkyarahtndvkqlteavqkittesiviwgktp
    kfklpiqketwetwwteywqatwipewefvntpplvklwyq