PDB entry 6ecj

View 6ecj on RCSB PDB site
Description: Human cytochrome c G41T
Class: apoptosis
Keywords: cytochrome c, heme, apoptosis, glycine to threonine substitution
Deposited on 2018-08-08, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6ecja_
  • Chain 'B':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6ecjb_
  • Chain 'C':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6ecjc_
  • Chain 'D':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6ecjd_
  • Chain 'E':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6ecje_
  • Chain 'F':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6ecjf_
  • Chain 'G':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6ecjg_
  • Chain 'H':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6ecjh_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ecjA (A:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrkttqapgysytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ecjB (B:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrkttqapgysytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ecjC (C:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrkttqapgysytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ecjD (D:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrkttqapgysytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ecjE (E:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrkttqapgysytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ecjF (F:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrkttqapgysytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ecjG (G:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrkttqapgysytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ecjH (H:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrkttqapgysytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne