PDB entry 6eca

View 6eca on RCSB PDB site
Description: Lactobacillus rhamnosus Beta-glucuronidase
Class: hydrolase
Keywords: Glycosyl hydrolase, HYDROLASE
Deposited on 2018-08-07, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucuronidase
    Species: Lactobacillus rhamnosus [TaxId:47715]
    Gene: BGK71_00200, CCE29_06935, DBP98_01505, PY66_04435, PY91_01090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ecaa1, d6ecaa2, d6ecaa3
  • Chain 'B':
    Compound: beta-glucuronidase
    Species: Lactobacillus rhamnosus [TaxId:47715]
    Gene: BGK71_00200, CCE29_06935, DBP98_01505, PY66_04435, PY91_01090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ecab1, d6ecab2, d6ecab3
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ecaA (A:)
    mhhhhhhssgvdlgtenlyfqsnametsllypvtndqrtdqkldglwqfkfdeagegeks
    gwetgfhdgvsmpvpasfndfftdkasreytgdfwysrnffvpsaakgkalflrfdavth
    ratifvngkeirtheggflpfaadiseavkygaentvvvkgnnelsrealpagdtitlrn
    gkkmvrpffdfynysglnrsvhllslpqervldytttfalagndatvnytvetngdapvt
    vsladadgqvvataqgkqgalqvqnahlwqvrnaylytltiqlgddtqtpldtytdrigi
    rtikisgtdilvndkpiylkgfgrhedspfagrafdlnvekkdfalmkwigansfrtshy
    pydeqvykiadeegflltdevpavgfkmaaaaflgglnqsffkgpwlkklherhidqird
    likrdknhpsvlawslfnepdtidenavpyfkqifdeskdldpqgrprtftlseddtiet
    skvldfpdfymlnrypgwyhfggyqisdgeaglrdemdkwqkagvkkpvvftefgadtea
    glhklpsvmwteeyqvevlkmfsrvfddydfikgeqvwnladfqtvegnmrvngnkkgif
    trdrqpkaaaffyhdrwnklpldykak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ecaA (A:)
    tsllypvtndqrtdqkldglwqfkfdeagegeksgwetgfhdgvsmpvpasfndfftdka
    sreytgdfwysrnffvpsaakgkalflrfdavthratifvngkeirtheggflpfaadis
    eavkygaentvvvkgnnelsrealpagdtitlrngkkmvrpffdfynysglnrsvhllsl
    pqervldytttfalagndatvnytvetngdapvtvsladadgqvvataqgkqgalqvqna
    hlwqvrnaylytltiqlgddtqtpldtytdrigirtikisgtdilvndkpiylkgfgrhe
    dspfagrafdlnvekkdfalmkwigansfrtshypydeqvykiadeegflltdevpavgf
    kmasffkgpwlkklherhidqirdlikrdknhpsvlawslfnepdtidenavpyfkqifd
    eskdldpqgrprtftlseddtietskvldfpdfymlnrypgwyhfggyqisdgeaglrde
    mdkwqkagvkkpvvftefgadteaglhklpsvmwteeyqvevlkmfsrvfddydfikgeq
    vwnladfqtvegnmrvngnkkgiftrdrqpkaaaffyhdrwnklpldyka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ecaB (B:)
    mhhhhhhssgvdlgtenlyfqsnametsllypvtndqrtdqkldglwqfkfdeagegeks
    gwetgfhdgvsmpvpasfndfftdkasreytgdfwysrnffvpsaakgkalflrfdavth
    ratifvngkeirtheggflpfaadiseavkygaentvvvkgnnelsrealpagdtitlrn
    gkkmvrpffdfynysglnrsvhllslpqervldytttfalagndatvnytvetngdapvt
    vsladadgqvvataqgkqgalqvqnahlwqvrnaylytltiqlgddtqtpldtytdrigi
    rtikisgtdilvndkpiylkgfgrhedspfagrafdlnvekkdfalmkwigansfrtshy
    pydeqvykiadeegflltdevpavgfkmaaaaflgglnqsffkgpwlkklherhidqird
    likrdknhpsvlawslfnepdtidenavpyfkqifdeskdldpqgrprtftlseddtiet
    skvldfpdfymlnrypgwyhfggyqisdgeaglrdemdkwqkagvkkpvvftefgadtea
    glhklpsvmwteeyqvevlkmfsrvfddydfikgeqvwnladfqtvegnmrvngnkkgif
    trdrqpkaaaffyhdrwnklpldykak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ecaB (B:)
    metsllypvtndqrtdqkldglwqfkfdeagegeksgwetgfhdgvsmpvpasfndfftd
    kasreytgdfwysrnffvpsaakgkalflrfdavthratifvngkeirtheggflpfaad
    iseavkygaentvvvkgnnelsrealpagdtitlrngkkmvrpffdfynysglnrsvhll
    slpqervldytttfalagndatvnytvetngdapvtvsladadgqvvataqgkqgalqvq
    nahlwqvrnaylytltiqlgddtqtpldtytdrigirtikisgtdilvndkpiylkgfgr
    hedspfagrafdlnvekkdfalmkwigansfrtshypydeqvykiadeegflltdevpav
    gfkmasffkgpwlkklherhidqirdlikrdknhpsvlawslfnepdtidenavpyfkqi
    fdeskdldpqgrprtftlseddtietskvldfpdfymlnrypgwyhfggyqisdgeaglr
    demdkwqkagvkkpvvftefgadteaglhklpsvmwteeyqvevlkmfsrvfddydfikg
    eqvwnladfqtvegnmrvngnkkgiftrdrqpkaaaffyhdrwnklpldyka