PDB entry 6eby

View 6eby on RCSB PDB site
Description: Crystal structure of the MbtH-like protein FscK bound to the interface forming region of FscH adenylation domain from Thermobifida fusca
Class: protein binding
Keywords: MbtH-like protein, adenylation domain, domain activation, PROTEIN BINDING
Deposited on 2018-08-07, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Conserved protein MbtH
  Species: Thermobifida fusca (strain YX) [TaxId:269800]
  Gene: Tfu_1863
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47NS3
  Domains in SCOPe 2.07: d6ebya_
• Chain 'B':
  Compound: Amino acid adenylation
  Species: Thermobifida fusca (strain YX) [TaxId:269800]
  Gene: Tfu_1866
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47NS0 (0-76)
• Chain 'C':
  Compound: Conserved protein MbtH
  Species: Thermobifida fusca (strain YX) [TaxId:269800]
  Gene: Tfu_1863
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47NS3
  Domains in SCOPe 2.07: d6ebyc_
• Chain 'D':
  Compound: Amino acid adenylation
  Species: Thermobifida fusca (strain YX) [TaxId:269800]
  Gene: Tfu_1866
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47NS0 (0-76)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6ebyA (A:)
  amadigsmtnpfdddegvflvlvndedqyslwpefaevpqgwrtvfgptsraaaldyint
  hwtdlrprslreameahstag
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6ebyA (A:)
  npfdddegvflvlvndedqyslwpefaevpqgwrtvfgptsraaaldyinthwt
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >6ebyC (C:)
  amadigsmtnpfdddegvflvlvndedqyslwpefaevpqgwrtvfgptsraaaldyint
  hwtdlrprslreameahstag
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6ebyC (C:)
  npfdddegvflvlvndedqyslwpefaevpqgwrtvfgptsraaaldyinthwt
  

  
  
• Chain 'D':
  No sequence available.