PDB entry 6ebw

View 6ebw on RCSB PDB site
Description: hALK in complex with compound 9 (6-(((1S)-1-(5-Fluoropyridin-2-yl)ethyl)amino)-1-(3-methyl-1H-pyrazol-5-yl)-1H-pyrrolo[2,3-b]pyridin-3-yl)(morpholin-4-yl)methanone
Class: transferase/inhibitor
Keywords: Inhibitor, complex, kinase, sbdd, TRANSFERASE-INHIBITOR complex
Deposited on 2018-08-07, released 2019-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ALK tyrosine kinase receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ALK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ebwa_
  • Heterogens: J3Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ebwA (A:)
    gamgstdynpnycfagktssisdlkevprknitlirglghgafgevyegqvsgmpndpsp
    lqvavktlpevcseqdeldflmealiiskfnhqnivrcigvslqslprfillelmaggdl
    ksflretrprpsqpsslamldllhvardiacgcqyleenhfihrdiaarnclltcpgpgr
    vakigdfgmardiyrasyyrkggcamlpvkwmppeafmegiftsktdtwsfgvllweifs
    lgympypsksnqevlefvtsggrmdppkncpgpvyrimtqcwqhqpedrpnfaiilerie
    yctqdpdvintalpieygplve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebwA (A:)
    ycftssisdlkevprknitlirglghfgevyegqvssplqvavktlpevcseqdeldflm
    ealiiskfnhqnivrcigvslqslprfillelmaggdlksflretrprppsslamldllh
    vardiacgcqyleenhfihrdiaarnclltcpgpgrvakigdfgmardlpvkwmppeafm
    egiftsktdtwsfgvllweifslgympypsksnqevlefvtsggrmdppkncpgpvyrim
    tqcwqhqpedrpnfaiilerieyctqdpdvintalpi