PDB entry 6ebv

View 6ebv on RCSB PDB site
Description: Staphylococcus aureus Type II pantothenate kinase in complex with ADP and pantothenate analog Deoxy-N7-Pan
Class: transferase
Keywords: Staphylococcus aureus, SaPanK, ADP, pantothenate analog, TRANSFERASE
Deposited on 2018-08-07, released 2019-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-07, with a file datestamp of 2019-08-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: coaW, BTN44_13005, C3B39_13135, EP54_10775, EQ90_06670, HMPREF3211_02599
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ebva_
  • Chain 'B':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: coaW, BTN44_13005, C3B39_13135, EP54_10775, EQ90_06670, HMPREF3211_02599
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ebvb_
  • Chain 'C':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: coaW, BTN44_13005, C3B39_13135, EP54_10775, EQ90_06670, HMPREF3211_02599
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ebvc_
  • Chain 'D':
    Compound: Type II pantothenate kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: coaW, BTN44_13005, C3B39_13135, EP54_10775, EQ90_06670, HMPREF3211_02599
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ebvd_
  • Heterogens: ADP, 27Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ebvA (A:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalylek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebvA (A:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalyle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ebvB (B:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalylek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebvB (B:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalyle
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ebvC (C:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalylek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ebvD (D:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalylek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebvD (D:)
    mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
    inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
    ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
    hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
    tvlrgckpyyvengafsgaigalyl