PDB entry 6ebt

View 6ebt on RCSB PDB site
Description: Crystal structure of recombinant mutant N107T of human fumarase
Class: lyase
Keywords: HsFH, fumarate hydratase, LYASE
Deposited on 2018-08-07, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarate hydratase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07954 (Start-465)
      • engineered mutation (62)
    Domains in SCOPe 2.07: d6ebta_
  • Chain 'B':
    Compound: Fumarate hydratase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07954 (Start-465)
      • engineered mutation (62)
    Domains in SCOPe 2.07: d6ebtb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ebtA (A:)
    asqnsfrieydtfgelkvpndkyygaqtvrstmnfkiggvtermptpvikafgilkraaa
    evtqdygldpkianaimkaadevaegklndhfplvvwqtgsgtqtnmnvnevisnraiem
    lggelgskipvhpndhvnksqssndtfptamhiaaaievhevllpglqklhdaldakske
    faqiikigrthtqdavpltlgqefsgyvqqvkyamtrikaampriyelaaggtavgtgln
    trigfaekvaakvaaltglpfvtapnkfealaahdalvelsgamnttacslmkiandirf
    lgsgprsglgelilpenepgssimpgkvnptqceamtmvaaqvmgnhvavtvggsnghfe
    lnvfkpmmiknvlhsarllgdasvsftencvvgiqanterinklmneslmlvtalnphig
    ydkaakiaktahkngstlketaielgyltaeqfdewvkpkdmlgpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebtA (A:)
    sfrieydtfgelkvpndkyygaqtvrstmnfkiggvtermptpvikafgilkraaaevtq
    dygldpkianaimkaadevaegklndhfplvvwqtgsgtqtnmnvnevisnraiemlgge
    lgskipvhpndhvnksqssndtfptamhiaaaievhevllpglqklhdaldakskefaqi
    ikigrthtqdavpltlgqefsgyvqqvkyamtrikaampriyelaaggtavgtglntrig
    faekvaakvaaltglpfvtapnkfealaahdalvelsgamnttacslmkiandirflgsg
    prsglgelilpenepgssimpgkvnptqceamtmvaaqvmgnhvavtvggsnghfelnvf
    kpmmiknvlhsarllgdasvsftencvvgiqanterinklmneslmlvtalnphigydka
    akiaktahkngstlketaielgyltaeqfdewvkpkdmlgpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ebtB (B:)
    asqnsfrieydtfgelkvpndkyygaqtvrstmnfkiggvtermptpvikafgilkraaa
    evtqdygldpkianaimkaadevaegklndhfplvvwqtgsgtqtnmnvnevisnraiem
    lggelgskipvhpndhvnksqssndtfptamhiaaaievhevllpglqklhdaldakske
    faqiikigrthtqdavpltlgqefsgyvqqvkyamtrikaampriyelaaggtavgtgln
    trigfaekvaakvaaltglpfvtapnkfealaahdalvelsgamnttacslmkiandirf
    lgsgprsglgelilpenepgssimpgkvnptqceamtmvaaqvmgnhvavtvggsnghfe
    lnvfkpmmiknvlhsarllgdasvsftencvvgiqanterinklmneslmlvtalnphig
    ydkaakiaktahkngstlketaielgyltaeqfdewvkpkdmlgpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebtB (B:)
    sfrieydtfgelkvpndkyygaqtvrstmnfkiggvtermptpvikafgilkraaaevtq
    dygldpkianaimkaadevaegklndhfplvvwqtgsgtqtnmnvnevisnraiemlgge
    lgskipvhpndhvnksqssndtfptamhiaaaievhevllpglqklhdaldakskefaqi
    ikigrthtqdavpltlgqefsgyvqqvkyamtrikaampriyelaaggtavgtglntrig
    faekvaakvaaltglpfvtapnkfealaahdalvelsgamnttacslmkiandirflgsg
    prsglgelilpenepgssimpgkvnptqceamtmvaaqvmgnhvavtvggsnghfelnvf
    kpmmiknvlhsarllgdasvsftencvvgiqanterinklmneslmlvtalnphigydka
    akiaktahkngstlketaielgyltaeqfdewvkpkdmlgpk