PDB entry 6ebd

View 6ebd on RCSB PDB site
Description: OhrB (Organic Hydroperoxide Resistance protein) mutant (C60A) from Chromobacterium violaceum, interacting with dihydrolipoamide
Class: oxidoreductase
Keywords: Ohr, thiol-proxidase, Dihydrolipoamide, OXIDOREDUCTASE
Deposited on 2018-08-06, released 2020-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum [TaxId:536]
    Gene: CBW21_15220
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A202B6V5 (Start-160)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d6ebda_
  • Chain 'B':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum [TaxId:536]
    Gene: CBW21_15220
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A202B6V5 (Start-160)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d6ebdb_
  • Chain 'C':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum [TaxId:536]
    Gene: CBW21_15220
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A202B6V5 (20-160)
      • expression tag (18-19)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d6ebdc1, d6ebdc2
  • Chain 'D':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum [TaxId:536]
    Gene: CBW21_15220
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A202B6V5 (Start-160)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d6ebdd_
  • Heterogens: J3S, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ebdA (A:)
    mgsshhhhhhssglvprgshmsietilyrtqatvsggregnaessdgalkvqlstprelg
    gaggpgtnpeqlfaagyaaaflgslkfvaakrkttlsadasvscgvgigtlpsgfgleve
    lqirlpglsdeearqlieqahivcpysdatrgnidvrlrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebdA (A:)
    sietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaaaf
    lgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqah
    ivcpysdatrgnidvrlrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ebdB (B:)
    mgsshhhhhhssglvprgshmsietilyrtqatvsggregnaessdgalkvqlstprelg
    gaggpgtnpeqlfaagyaaaflgslkfvaakrkttlsadasvscgvgigtlpsgfgleve
    lqirlpglsdeearqlieqahivcpysdatrgnidvrlrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebdB (B:)
    sietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaaaf
    lgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqah
    ivcpysdatrgnidvrlrla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ebdC (C:)
    mgsshhhhhhssglvprgshmsietilyrtqatvsggregnaessdgalkvqlstprelg
    gaggpgtnpeqlfaagyaaaflgslkfvaakrkttlsadasvscgvgigtlpsgfgleve
    lqirlpglsdeearqlieqahivcpysdatrgnidvrlrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebdC (C:)
    shmsietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagya
    aaflgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlie
    qahivcpysdatrgnidvrlrla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ebdD (D:)
    mgsshhhhhhssglvprgshmsietilyrtqatvsggregnaessdgalkvqlstprelg
    gaggpgtnpeqlfaagyaaaflgslkfvaakrkttlsadasvscgvgigtlpsgfgleve
    lqirlpglsdeearqlieqahivcpysdatrgnidvrlrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebdD (D:)
    sietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaaaf
    lgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqah
    ivcpysdatrgnidvrlrla