PDB entry 6ebb

View 6ebb on RCSB PDB site
Description: Crystal Structure of YycF homologue, crystals grown in Tris buffer
Class: signaling protein
Keywords: YycF, Essential, Response Regulator, Receiver Domain, SIGNALING PROTEIN
Deposited on 2018-08-06, released 2019-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding response regulator
    Species: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) [TaxId:170187]
    Gene: SP_1227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ebba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ebbA (A:)
    mkkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidg
    levaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrrsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ebbA (A:)
    kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidgl
    evaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrrs