PDB entry 6eb7

View 6eb7 on RCSB PDB site
Description: YycF homologue (SP1227) Receiver Domain Activated by BeF3
Class: signaling protein
Keywords: BeF3 Activated, YycF Homologue, Response Regulator, SIGNALING PROTEIN
Deposited on 2018-08-05, released 2019-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding response regulator
    Species: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) [TaxId:170187]
    Gene: SP_1227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6eb7a_
  • Heterogens: BEF, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eb7A (A:)
    kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidgl
    evaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrr