PDB entry 6eb6

View 6eb6 on RCSB PDB site
Description: Crystal structure of BAX W139A monomer
Class: apoptosis
Keywords: BAX, inactive monomer, APOPTOSIS
Deposited on 2018-08-05, released 2019-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator BAX
    Species: Homo sapiens [TaxId:9606]
    Gene: BAX, BCL2L4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07812
      • engineered mutation (138)
    Domains in SCOPe 2.08: d6eb6a_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eb6A (A:)
    mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
    eclkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
    vlkalctkvpelirtimgatldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagv
    ltasltiwkkmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eb6A (A:)
    ptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkklseclkrigdelds
    nmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalctkvpel
    irtimgatldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagvltasltiwkkm