PDB entry 6eb4

View 6eb4 on RCSB PDB site
Description: OhrB (Organic Hydroperoxide Resistance protein) from Chromobacterium violaceum
Class: oxidoreductase
Keywords: Ohr, thiol-proxidase, OXIDOREDUCTASE
Deposited on 2018-08-04, released 2020-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum [TaxId:536]
    Gene: CBW21_15220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eb4a_
  • Chain 'B':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum [TaxId:536]
    Gene: CBW21_15220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eb4b_
  • Chain 'C':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum [TaxId:536]
    Gene: CBW21_15220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eb4c_
  • Chain 'D':
    Compound: organic hydroperoxide resistance protein
    Species: Chromobacterium violaceum [TaxId:536]
    Gene: CBW21_15220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eb4d_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eb4A (A:)
    mgsshhhhhhssglvprgshmsietilyrtqatvsggregnaessdgalkvqlstprelg
    gaggpgtnpeqlfaagyaacflgslkfvaakrkttlsadasvscgvgigtlpsgfgleve
    lqirlpglsdeearqlieqahivcpysdatrgnidvrlrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eb4A (A:)
    msietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaac
    flgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqa
    hivcpysdatrgnidvrlrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eb4B (B:)
    mgsshhhhhhssglvprgshmsietilyrtqatvsggregnaessdgalkvqlstprelg
    gaggpgtnpeqlfaagyaacflgslkfvaakrkttlsadasvscgvgigtlpsgfgleve
    lqirlpglsdeearqlieqahivcpysdatrgnidvrlrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eb4B (B:)
    sietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaacf
    lgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqah
    ivcpysdatrgnidvrlrla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6eb4C (C:)
    mgsshhhhhhssglvprgshmsietilyrtqatvsggregnaessdgalkvqlstprelg
    gaggpgtnpeqlfaagyaacflgslkfvaakrkttlsadasvscgvgigtlpsgfgleve
    lqirlpglsdeearqlieqahivcpysdatrgnidvrlrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eb4C (C:)
    sietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaacf
    lgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqah
    ivcpysdatrgnidvrlrla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6eb4D (D:)
    mgsshhhhhhssglvprgshmsietilyrtqatvsggregnaessdgalkvqlstprelg
    gaggpgtnpeqlfaagyaacflgslkfvaakrkttlsadasvscgvgigtlpsgfgleve
    lqirlpglsdeearqlieqahivcpysdatrgnidvrlrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eb4D (D:)
    sietilyrtqatvsggregnaessdgalkvqlstprelggaggpgtnpeqlfaagyaacf
    lgslkfvaakrkttlsadasvscgvgigtlpsgfglevelqirlpglsdeearqlieqah
    ivcpysdatrgnidvrlrla