PDB entry 6eb1

View 6eb1 on RCSB PDB site
Description: HIV-1 Integrase Catalytic Core Domain Complexed with Allosteric Inhibitor (2S)-tert-butoxy[3-(3,4-dihydro-2H-1-benzopyran-6-yl)-1-phenylisoquinolin-4-yl]acetic acid
Class: transferase/transferase inhibitor
Keywords: HIV, Integrase, inhibitor, allosteric, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-08-03, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2WR52
      • engineered mutation (155)
    Domains in SCOPe 2.07: d6eb1a_
  • Heterogens: J3M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eb1A (A:)
    mgsshhhhhhssglvprgshmhgqvdcspgiwqldcthlegkvilvavhvasgyieaevi
    paetgqetayfllklagrwpvktvhtdngsnftsttvkaacwwagikqefgipynpqsqg
    viesmnkelkkiigqvrdqaehlktavqmavfihnhkrkggiggysagerivdiiatdiq
    tke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eb1A (A:)
    cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
    dngsnftsttvkaacwwagikqefgismnkelkkiigqvrdqaehlktavqmavfihnhk
    rysagerivdiiatd