PDB entry 6eas

View 6eas on RCSB PDB site
Description: Co-crystal of pseudokinase DRIK1 (drought responsive inactive kinase 1) bound to ENMD-2076
Class: transferase/transferase inhibitor
Keywords: Receptor-like kinase, pseudokinase, maize, ENMD-2076, Structural Genomics Consortium, TRANSFERASE-TRANSFERASE INHIBITOR complex, SGC
Deposited on 2018-08-03, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: drought responsive inactive kinase 1
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6easa_
  • Heterogens: J3A, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6easA (A:)
    smrakkmgtvrpwatglsgqlqkafvtgvpslkrseletacedfsniigststcmlykgt
    lssgveiavasslvtsakdwskenesqyrkkitnlskvshknfmnllgyceeehpftrvm
    vfeyapngtlfehlhvreaekldwmarlrismgiayclehmhqlqtpaalrnfdsttvyl
    tddfaakvsdlefwndakghnsttnnelafspdmedivrkygmvlleiltgrvpsseddg
    plenwvsryfeggmrleelidpsigffpedtaralcevvrscidrdpkkrpqmkevaarm
    reitalgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6easA (A:)
    afvtgvpslkrseletacedfsniigststcmlykgtlssgveiavasslvtsakdwske
    nesqyrkkitnlskvshknfmnllgyceeehpftrvmvfeyapngtlfehlhvreaekld
    wmarlrismgiayclehmhqlqtpaalrnfdsttvyltddfaakvsdlefwnpdmedivr
    kygmvlleiltgrvpslenwvsryfeggmrleelidpsigffpedtaralcevvrscidr
    dpkkrpqmkevaarmreitalgp