PDB entry 6eaq

View 6eaq on RCSB PDB site
Description: Glycosylated FCGR3B / CD16b in complex with afucosylated IgG1 Fc
Class: immune system
Keywords: Glycosylation, Glycoprotein, IgG1 Fc, CD16b, FCGR3b, IMMUNE SYSTEM
Deposited on 2018-08-03, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eaqa1, d6eaqa2
  • Chain 'B':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eaqb1, d6eaqb2
  • Chain 'C':
    Compound: low affinity immunoglobulin gamma fc region receptor III-b
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR3B, CD16B, FCG3, FCGR3, IGFR3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75015
      • engineered mutation (63)
      • engineered mutation (73)
      • engineered mutation (168)
    Domains in SCOPe 2.07: d6eaqc1, d6eaqc2
  • Heterogens: NAG, BMA, MAN, GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eaqA (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eaqA (A:)
    lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpree
    qynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlpps
    rdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdk
    srwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eaqB (B:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eaqB (B:)
    ellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpr
    eeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlp
    psrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltv
    dksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6eaqC (C:)
    rtedlpkavvflepqwysvlekdsvtlkcqgayspedqstqwfhneslissqassyfida
    atvqdsgeyrcqtqlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhk
    vtylqngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvqititqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eaqC (C:)
    lpkavvflepqwysvlekdsvtlkcqgastqwfhneslissqassyfidaatvqdsgeyr
    cqtqlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvtylqngkdr
    kyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvqititq