PDB entry 6ea3

View 6ea3 on RCSB PDB site
Description: Thermobifida fusca FscH adenylation domain complexed with MbtH-like protein FscK and Ser-AMP
Class: ligase
Keywords: siderophore biosynthesis, serine activating adenylation domain, MbtH-like protein, seryl-adenylate, LIGASE
Deposited on 2018-08-02, released 2019-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-07, with a file datestamp of 2019-08-02.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: MbtH-like protein
  Species: Thermobifida fusca (strain YX) [TaxId:269800]
  Gene: Tfu_1863
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47NS3
  Domains in SCOPe 2.07: d6ea3a_
• Chain 'B':
  Compound: adenylation domain of Fuscachelin synthetase component H
  Species: Thermobifida fusca (strain YX) [TaxId:269800]
  Gene: Tfu_1866
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47NS0
• Heterogens: SRP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6ea3A (A:)
  amadigsmtnpfdddegvflvlvndedqyslwpefaevpqgwrtvfgptsraaaldyint
  hwtdlrprslreameahstag
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6ea3A (A:)
  tnpfdddegvflvlvndedqyslwpefaevpqgwrtvfgptsraaaldyinthwtdlrpr
  slreameahs
  

  
  
• Chain 'B':
  No sequence available.