PDB entry 6e90

View 6e90 on RCSB PDB site
Description: Ternary complex of human glycerol 3-phosphate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2018-07-31, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e90a1, d6e90a2
  • Chain 'B':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e90b1, d6e90b2
  • Chain 'C':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e90c1, d6e90c2
  • Chain 'D':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e90d1, d6e90d2
  • Heterogens: 13P, NAD, CA, MPD, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e90A (A:)
    maskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhen
    vkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislik
    gvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkel
    mqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafak
    lfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgp
    etarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e90A (A:)
    askkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhenv
    kylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislikg
    vdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelm
    qtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafakl
    fcssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpetare
    lysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e90B (B:)
    maskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhen
    vkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislik
    gvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkel
    mqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafak
    lfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgp
    etarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e90B (B:)
    skkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhenvk
    ylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislikgv
    degpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelmq
    tpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklf
    csgssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpetar
    elysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6e90C (C:)
    maskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhen
    vkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislik
    gvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkel
    mqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafak
    lfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgp
    etarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e90C (C:)
    skkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhenvk
    ylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislikgv
    degpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelmq
    tpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklf
    csgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpet
    arelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6e90D (D:)
    maskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhen
    vkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislik
    gvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkel
    mqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafak
    lfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgp
    etarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e90D (D:)
    askkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeelteiinhenvkylpghkl
    ppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislikgvdegplkl
    isevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelmqtpnfritvv
    qevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgpvssat
    flescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpetarelysilq
    hkglvdkfplfmavykvcyegqpvgefihclqnhpe