PDB entry 6e8z

View 6e8z on RCSB PDB site
Description: Binary complex of Human glycerol 3-phosphate dehydrogenase with NAD
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2018-07-31, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e8za1, d6e8za2
  • Chain 'B':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e8zb1, d6e8zb2
  • Heterogens: NAD, PO4, EDO, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e8zA (A:)
    maskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhen
    vkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislik
    gvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkel
    mqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafak
    lfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgp
    etarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e8zA (A:)
    askkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeedikklteiintqhenvky
    lpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislikglk
    lisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelmqtpnfritv
    vqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgpvssa
    tflescgvadlittcyggrnrkvaeafartgksieqlekellgqklqgpetarelysilq
    hkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e8zB (B:)
    maskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhen
    vkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislik
    gvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkel
    mqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafak
    lfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgp
    etarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e8zB (B:)
    askkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhenv
    kylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislikg
    lklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelmqtpnfri
    tvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgpvs
    satflescgvadlittcyggrnrkvaeafartgksieqlekelngqklqgpetarelysi
    lqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm