PDB entry 6e8y

View 6e8y on RCSB PDB site
Description: Unliganded Human Glycerol 3-Phosphate Dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2018-07-31, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e8ya1, d6e8ya2
  • Chain 'B':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: GPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e8yb1, d6e8yb2
  • Heterogens: PO4, 3SY, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e8yA (A:)
    maskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhen
    vkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislik
    gvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkel
    mqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafak
    lfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgp
    etarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e8yA (A:)
    askkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeedilteiintqhenvkylp
    ghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislikgvdeg
    pnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelmqtpn
    fritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsg
    pvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpetare
    lysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e8yB (B:)
    maskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhen
    vkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislik
    gvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkel
    mqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafak
    lfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgp
    etarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e8yB (B:)
    askkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhenv
    kylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislikg
    vlklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelmqtpnfr
    itvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgpv
    ssatflescgvadlittcyggrnrkvaeafartgksieqlekellnklqgpetarelysi
    lqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm