PDB entry 6e85

View 6e85 on RCSB PDB site
Description: 1.25 Angstrom Resolution Crystal Structure of 4-hydroxythreonine-4-phosphate Dehydrogenase from Klebsiella pneumoniae.
Class: hydrolase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, 4-hydroxythreonine-4-phosphate Dehydrogenase, HYDROLASE
Deposited on 2018-07-27, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-threonate 4-phosphate dehydrogenase
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:72407]
    Gene: pdxA, AN676_0302560, C4Z09_19135, C4Z14_08130, C4Z36_17000, C5Y00_08690, C5Y06_22400, CLQ72_17060, CVG30_05510
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e85a1, d6e85a2
  • Chain 'B':
    Compound: D-threonate 4-phosphate dehydrogenase
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:72407]
    Gene: pdxA, AN676_0302560, C4Z09_19135, C4Z14_08130, C4Z36_17000, C5Y00_08690, C5Y06_22400, CLQ72_17060, CVG30_05510
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e85b_
  • Heterogens: NI, FMT, POP, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e85A (A:)
    snamskmiavtmgdpagigpeiiikslaegalsgapvvvvgcaqtlrrilalnitprael
    riidhpaeasfspatinvideplsdpqglrpgevqaqagdlafrcirratalalegavaa
    iataplnkealhlaghaypghtellahltqttdyamvlyteklkvihitthislrqfldt
    lnqprietvigvadrflrrvgyprpriavagvnphagenglfgdeeirivapavaamrak
    gvevtgpcppdtvfmqchegmydmvvamyhdqghiplkllgfydgvnitaglpfirtsad
    hgtafdiawtgkaksesmatsielamhiaqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e85B (B:)
    snamskmiavtmgdpagigpeiiikslaegalsgapvvvvgcaqtlrrilalnitprael
    riidhpaeasfspatinvideplsdpqglrpgevqaqagdlafrcirratalalegavaa
    iataplnkealhlaghaypghtellahltqttdyamvlyteklkvihitthislrqfldt
    lnqprietvigvadrflrrvgyprpriavagvnphagenglfgdeeirivapavaamrak
    gvevtgpcppdtvfmqchegmydmvvamyhdqghiplkllgfydgvnitaglpfirtsad
    hgtafdiawtgkaksesmatsielamhiaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e85B (B:)
    skmiavtmgdpagigpeiiikslaegalsgapvvvvgcaqtlrrilalnitpraelriid
    hpaeasfspatinvideplsdpqglrpgevqaqagdlafrcirratalalegavaaiata
    plnkealhlaghaypghtellahltqttdyamvlyteklkvihitthislrqfldtlnqp
    rietvigvadrflrrvgyprpriavagvnphagenglfgdeeirivapavaamrakgvev
    tgpcppdtvfmqchegmydmvvamyhdqghiplkllgfygvnitaglpfirtsadhgtaf
    diawtgkaksesmatsielamhiaq