PDB entry 6e7m

View 6e7m on RCSB PDB site
Description: Crystal structure of the holo retinal-bound domain-swapped dimer Q108K:T51D:A28C mutant of human Cellular Retinol Binding Protein II
Class: lipid binding protein
Keywords: Retinol, iLBP, Protein Switch, LIPID BINDING PROTEIN
Deposited on 2018-07-26, released 2019-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (0-132)
      • engineered mutation (27)
      • engineered mutation (50)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d6e7ma_
  • Chain 'B':
    Compound: Retinol-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (0-132)
      • engineered mutation (27)
      • engineered mutation (50)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d6e7mb_
  • Chain 'C':
    Compound: Retinol-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (0-132)
      • engineered mutation (27)
      • engineered mutation (50)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d6e7mc_
  • Chain 'D':
    Compound: Retinol-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (0-132)
      • engineered mutation (27)
      • engineered mutation (50)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d6e7md_
  • Heterogens: ACT, GOL, RET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e7mA (A:)
    trdqngtwemesnenfegymkaldidfctrkiavrltqtkvidqdgdnfkdkttstfrny
    dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
    cgdqvcrqvfkkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e7mB (B:)
    trdqngtwemesnenfegymkaldidfctrkiavrltqtkvidqdgdnfkdkttstfrny
    dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
    cgdqvcrqvfkkk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e7mC (C:)
    trdqngtwemesnenfegymkaldidfctrkiavrltqtkvidqdgdnfkdkttstfrny
    dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
    cgdqvcrqvfkkk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e7mD (D:)
    trdqngtwemesnenfegymkaldidfctrkiavrltqtkvidqdgdnfkdkttstfrny
    dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
    cgdqvcrqvfkkk