PDB entry 6e7j

View 6e7j on RCSB PDB site
Description: HIV-1 wild type protease with GRL-042-17A, 3-phenylhexahydro-2h-cyclopenta[d]oxazol-2-one with a bicyclic oxazolidinone scaffold as the P2 ligand
Class: hydrolase/hydrolase inhibitor
Keywords: ANTIVIRAL, HIV-1 PROTEASE INHIBITOR OF GRL-042-17A, P2 LIGAND, MULTIDRUG-RESISTANT, OXAZOLIDINONE, VIRAL PROTEIN, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2018-07-26, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5RZ08 (0-98)
      • conflict (6)
      • conflict (32)
      • conflict (62)
      • conflict (66)
      • conflict (94)
    Domains in SCOPe 2.07: d6e7ja_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5RZ08 (0-98)
      • conflict (6)
      • conflict (32)
      • conflict (62)
      • conflict (66)
      • conflict (94)
    Domains in SCOPe 2.07: d6e7jb_
  • Heterogens: HWY, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e7jA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e7jB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf