PDB entry 6e7g

View 6e7g on RCSB PDB site
Description: Crystal structure of H5 hemagglutinin mutant Y161A from A/Viet Nam/1203/2004 H5N1 influenza virus
Class: viral protein
Keywords: Influenza virus, hemagglutinin, HA, H5N1, A/Viet Nam/1203/2004, Receptor specificity, VIRAL PROTEIN
Deposited on 2018-07-26, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP31 (4-End)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d6e7ga_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e7gb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP31
      • engineered mutation (160)
    Domains in SCOPe 2.07: d6e7gc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e7gd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP31
      • engineered mutation (160)
    Domains in SCOPe 2.07: d6e7ge_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e7gf_
  • Heterogens: NAG, BMA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e7gA (A:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstaptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7gA (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
    llgnpmcdnvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipkssws
    lgvssacpyqgkssffrnvvwlikknstaptikrsynntnqedllvlwgihhpndaaeqt
    klyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndainfesngnfi
    apeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltigecpkyvks
    nrlvlatglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e7gB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7gB (B:)
    gaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqf
    eavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvr
    lqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6e7gC (C:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstaptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7gC (C:)
    icigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagwll
    gnpmcdinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipksswsa
    slgvssacpyqgkssffrnvvwlikknstaptikrsynntnqedllvlwgihhpndaaeq
    tklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndainfesngnf
    iapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltigecpkyvk
    snrlvlatglrns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6e7gD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7gD (D:)
    fieggwqgmvdgwyyhhsneqyaadkestqkaidgvtnkvnsiidkmntqfeavgrefnn
    lerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdnake
    lgngcfefhkcdnecmesvrngtydypqyseearlkree
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6e7gE (E:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstaptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7gE (E:)
    cigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagwllg
    npmcdevpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipksswsasl
    gvssacpyqgkssffrnvvwlikknstaptikrsynntnqedllvlwgihhpndaaeqtk
    lyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndainfesngnfia
    peyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltigecpkyvksn
    rlvlatglrns
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6e7gF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e7gF (F:)
    gfieggwqgmvdgwygyhhsneqadkestqkaidgvtnkvnsiidkmntqfeavgrefnn
    lerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdnake
    lngcfhkcdnecmesvrngtydypqyseearlkree