PDB entry 6e77

View 6e77 on RCSB PDB site
Description: Structure of Human Transthyretin Asp38Ala Mutant in Complex with Tafamidis
Class: transport protein
Keywords: human transthyretin, amyloid, transthyretin, tafamidis, TRANSPORT PROTEIN
Deposited on 2018-07-25, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-114)
      • engineered mutation (28)
    Domains in SCOPe 2.07: d6e77a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-114)
      • engineered mutation (28)
    Domains in SCOPe 2.07: d6e77b_
  • Heterogens: 3MI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6e77A (A:)
cplmvkvldavrgspainvavhvfrkaaadtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6e77B (B:)
cplmvkvldavrgspainvavhvfrkaaadtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn