PDB entry 6e6o

View 6e6o on RCSB PDB site
Description: Pheromone from Euplotes raikovi, Er-1
Class: signaling protein
Keywords: pheromone, signaling protein
Deposited on 2018-07-25, released 2019-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-07, with a file datestamp of 2019-08-02.
Experiment type: XRAY
Resolution: 0.7 Å
R-factor: N/A
AEROSPACI score: 1.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mating pheromone Er-1/Er-3
    Species: Euplotes raikovi [TaxId:5938]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e6oa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6e6oA (A:)
    daceqaaiqcvesaceslctegedrtgcymyiysncppyv