PDB entry 6e6k

View 6e6k on RCSB PDB site
Description: Crystal structure of human cellular retinol-binding protein 4 in complex with abnormal-cannabidiol (abn-CBD)
Class: lipid binding protein
Keywords: vitamin A, retinol, abn-CBD, abnormal cannabidiol, LIPID BINDING PROTEIN
Deposited on 2018-07-25, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoid-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96R05 (0-132)
      • expression tag (133)
    Domains in SCOPe 2.07: d6e6ka1, d6e6ka2
  • Heterogens: HVD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e6kA (A:)
    padlsgtwtllssdnfegymlalgidfatrkiakllkpqkvieqngdsftihtnsslrny
    fvkfkvgeefdednrgldnrkckslviwdndrltciqkgekknrgwthwiegdklhlemf
    cegqvckqtfqralvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e6kA (A:)
    padlsgtwtllssdnfegymlalgidfatrkiakllkpqkvieqngdsftihtnsslrny
    fvkfkvgeefdednrgldnrkckslviwdndrltciqkgekknrgwthwiegdklhlemf
    cegqvckqtfqral