PDB entry 6e6j

View 6e6j on RCSB PDB site
Description: BRD2_Bromodomain2 complex with inhibitor 744
Class: signaling protein
Keywords: bet, signaling protein
Deposited on 2018-07-25, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d6e6ja1, d6e6ja2
  • Chain 'B':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d6e6jb1, d6e6jb2
  • Chain 'C':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d6e6jc1, d6e6jc2
  • Chain 'D':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d6e6jd1, d6e6jd2
  • Chain 'E':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d6e6je1, d6e6je2
  • Chain 'F':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d6e6jf1, d6e6jf2
  • Heterogens: HWV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e6jA (A:)
    gshmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkm
    enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e6jA (A:)
    hmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
    rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e6jB (B:)
    gshmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkm
    enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e6jB (B:)
    hmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
    rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6e6jC (C:)
    gshmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkm
    enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e6jC (C:)
    hmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
    rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6e6jD (D:)
    gshmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkm
    enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e6jD (D:)
    hmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
    rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6e6jE (E:)
    gshmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkm
    enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e6jE (E:)
    hmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
    rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6e6jF (F:)
    gshmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkm
    enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e6jF (F:)
    hmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
    rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmp