PDB entry 6e6g

View 6e6g on RCSB PDB site
Description: KRAS G13D bound to GDP (K13GDP)
Class: signaling protein
Keywords: Oncogene, RAS, p21, SIGNALING PROTEIN
Deposited on 2018-07-24, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: GTPase KRas
  Species: Homo sapiens [TaxId:9606]
  Gene: KRAS, KRAS2, RASK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01116 (0-165)
    • engineered mutation (12)
  Domains in SCOPe 2.07: d6e6ga_
• Heterogens: GDP, CA, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6e6gA (A:)
  mteyklvvvgagdvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
  qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
  psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkh