PDB entry 6e6c

View 6e6c on RCSB PDB site
Description: HRAS G13D bound to GppNHp (H13GNP)
Class: signaling protein
Keywords: Oncogene, RAS, p21, SIGNALING PROTEIN
Deposited on 2018-07-24, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d6e6ca_
  • Heterogens: MG, GNP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e6cA (A:)
    mteyklvvvgagdvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e6cA (A:)
    mteyklvvvgagdvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    eysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaa
    rtvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh