PDB entry 6e64

View 6e64 on RCSB PDB site
Description: Crystal structure of malaria transmission-blocking antibody 85RF45.1
Class: immune system
Keywords: malaria, transmission-blocking, antibody, IMMUNE SYSTEM
Deposited on 2018-07-23, released 2018-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 85RF45.1 Fab heavy chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E64 (0-End)
    Domains in SCOPe 2.08: d6e64a_
  • Chain 'B':
    Compound: 85RF45.1 Fab light chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E64 (0-End)
    Domains in SCOPe 2.08: d6e64b1, d6e64b2
  • Chain 'H':
    Compound: 85RF45.1 Fab heavy chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E64 (0-End)
    Domains in SCOPe 2.08: d6e64h_
  • Chain 'L':
    Compound: 85RF45.1 Fab light chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 6E64 (0-End)
    Domains in SCOPe 2.08: d6e64l1, d6e64l2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e64A (A:)
    evqlvesgggllqpgrslklscvasgftfnnywmswirqapgkglewiasisniggtiyy
    pdsvkgrftisrdsaqntlylqmnslrsedtatyyctrdlrmsdyfdywgqgtmvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e64A (A:)
    evqlvesgggllqpgrslklscvasgftfnnywmswirqapgkglewiasisniggtiyy
    pdsvkgrftisrdsaqntlylqmnslrsedtatyyctrdlrmsdyfdywgqgtmvtvssa
    stkgpsvfplapssktaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e64B (B:)
    qfvlsqpnsvstnlgstvkllckrstgnigsnyvswyqhhegrspttmiyrddqrpdgvp
    drfsgsidrssnsalltidnvqtedeaayfchsystgmyifgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e64B (B:)
    qfvlsqpnsvstnlgstvkllckrstgnigsnyvswyqhhegrspttmiyrddqrpdgvp
    drfsgsidrssnsalltidnvqtedeaayfchsystgmyifgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6e64H (H:)
    evqlvesgggllqpgrslklscvasgftfnnywmswirqapgkglewiasisniggtiyy
    pdsvkgrftisrdsaqntlylqmnslrsedtatyyctrdlrmsdyfdywgqgtmvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e64H (H:)
    evqlvesgggllqpgrslklscvasgftfnnywmswirqapgkglewiasisniggtiyy
    pdsvkgrftisrdsaqntlylqmnslrsedtatyyctrdlrmsdyfdywgqgtmvtvssa
    stkgpsvfplapsskggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6e64L (L:)
    qfvlsqpnsvstnlgstvkllckrstgnigsnyvswyqhhegrspttmiyrddqrpdgvp
    drfsgsidrssnsalltidnvqtedeaayfchsystgmyifgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e64L (L:)
    qfvlsqpnsvstnlgstvkllckrstgnigsnyvswyqhhegrspttmiyrddqrpdgvp
    drfsgsidrssnsalltidnvqtedeaayfchsystgmyifgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt