PDB entry 6e5y

View 6e5y on RCSB PDB site
Description: 1.50 Angstrom Resolution Crystal Structure of Argininosuccinate Synthase from Bordetella pertussis in Complex with AMP.
Class: hydrolase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Argininosuccinate Synthase, AMP, HYDROLASE
Deposited on 2018-07-23, released 2018-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: argininosuccinate synthase
    Species: Bordetella pertussis [TaxId:257313]
    Gene: argG, BP3537
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6e5ya1, d6e5ya2
  • Heterogens: AMP, CL, SO4, EDO, MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e5yA (A:)
    snamttilpnlptgqkvgiafsggldtsaallwmrqkgavpyaytanlgqpdepdydeip
    rramqygaeaarlvdcraqlvaegiaalqagafhistagltyfnttpigravtgtmlvaa
    mkedgvniwgdgstfkgndierfyryglltnpdlkiykpwldqtfidelggraemseymr
    qagfdykmsaekaystdsnmlgatheakdlellsagirivqpimgvafwqdsvqikaeev
    tvrfeegqpvalngveyadpvellleanriggrhglgmsdqienriieaksrgiyeapgl
    allfiayerlvtgihnedtieqyrengrklgrllyqgrwfdpqaimlretaqrwvarait
    gevtlelrrgndysllntesanltyaperlsmekvenapftpadrigqltmrnldivdtr
    eklftyvktgllapsagsalpqikdgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5yA (A:)
    ttilpnlptgqkvgiafsggldtsaallwmrqkgavpyaytanlgqpdepdydeiprram
    qygaeaarlvdcraqlvaegiaalqagafhistagltyfnttpigravtgtmlvaamked
    gvniwgdgstfkgndierfyryglltnpdlkiykpwldqtfidelggraemseymrqagf
    dykmsaekaystdsnmlgatheakdlellsagirivqpimgvafwqdsvqikaeevtvrf
    eegqpvalngveyadpvellleanriggrhglgmsdqienriieaksrgiyeapglallf
    iayerlvtgihnedtieqyrengrklgrllyqgrwfdpqaimlretaqrwvaraitgevt
    lelrrgndysllntesanltyaperlsmekvenapftpadrigqltmrnldivdtreklf
    tyvktgllapsalpqikd