PDB entry 6e5w

View 6e5w on RCSB PDB site
Description: Crystal structure of human cellular retinol binding protein 3 in complex with abnormal-cannabidiol (abn-CBD)
Class: lipid binding protein
Keywords: vitamin A, retinol, abn-CBD, abnormal cannabidiol, cellular retinol-binding protein, CRBP3, LIPID BINDING PROTEIN
Deposited on 2018-07-23, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5wa_
  • Chain 'B':
    Compound: Retinol-binding protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5wb_
  • Chain 'C':
    Compound: Retinol-binding protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5wc_
  • Chain 'D':
    Compound: Retinol-binding protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e5wd_
  • Heterogens: HVD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e5wA (A:)
    mppnltgyyrfvsqknmedylqalnislavrkialllkpdkeiehqgnhmtvrtlstfrn
    ytvqfdvgvefeedlrsvdgrkcqtivtweeehlvcvqkgevpnrgwrhwlegemlylel
    tardavceqvfrkvrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5wA (A:)
    pnltgyyrfvsqknmedylqalnislavrkialllkpdkeiehqgnhmtvrtlstfrnyt
    vqfdvgvefeedlrsvdgrkcqtivtweeehlvcvqkgevpnrgwrhwlegemlylelta
    rdavceqvfrkvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e5wB (B:)
    mppnltgyyrfvsqknmedylqalnislavrkialllkpdkeiehqgnhmtvrtlstfrn
    ytvqfdvgvefeedlrsvdgrkcqtivtweeehlvcvqkgevpnrgwrhwlegemlylel
    tardavceqvfrkvrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5wB (B:)
    pnltgyyrfvsqknmedylqalnislavrkialllkpdkeiehqgnhmtvrtlstfrnyt
    vqfdvgvefeedlrsvdgrkcqtivtweeehlvcvqkgevpnrgwrhwlegemlylelta
    rdavceqvfrkvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6e5wC (C:)
    mppnltgyyrfvsqknmedylqalnislavrkialllkpdkeiehqgnhmtvrtlstfrn
    ytvqfdvgvefeedlrsvdgrkcqtivtweeehlvcvqkgevpnrgwrhwlegemlylel
    tardavceqvfrkvrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5wC (C:)
    pnltgyyrfvsqknmedylqalnislavrkialllkpdkeiehqgnhmtvrtlstfrnyt
    vqfdvgvefeedlrsvdgrkcqtivtweeehlvcvqkgevpnrgwrhwlegemlylelta
    rdavceqvfrkvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6e5wD (D:)
    mppnltgyyrfvsqknmedylqalnislavrkialllkpdkeiehqgnhmtvrtlstfrn
    ytvqfdvgvefeedlrsvdgrkcqtivtweeehlvcvqkgevpnrgwrhwlegemlylel
    tardavceqvfrkvrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5wD (D:)
    pnltgyyrfvsqknmedylqalnislavrkialllkpdkeiehqgnhmtvrtlstfrnyt
    vqfdvgvefeedlrsvdgrkcqtivtweeehlvcvqkgevpnrgwrhwlegemlylelta
    rdavceqvfrkv