PDB entry 6e5v

View 6e5v on RCSB PDB site
Description: human mGlu8 receptor amino terminal domain in complex with (S)-3,4-Dicarboxyphenylglycine (DCPG)
Class: signaling protein
Keywords: mGluR8 ATD, GRM8, DCPG, SIGNALING PROTEIN
Deposited on 2018-07-23, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metabotropic glutamate receptor 8
    Species: Homo sapiens [TaxId:9606]
    Gene: GRM8, GPRC1H, MGLUR8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00222
      • engineered mutation (246)
    Domains in SCOPe 2.07: d6e5va_
  • Chain 'B':
    Compound: Metabotropic glutamate receptor 8
    Species: Homo sapiens [TaxId:9606]
    Gene: GRM8, GPRC1H, MGLUR8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00222
      • engineered mutation (246)
    Domains in SCOPe 2.07: d6e5vb_
  • Heterogens: HVG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e5vA (A:)
    malvcegkrsascpcfflltakfywiltmmrthsqeyahsirvdgdiilgglfpvhakge
    rgvpcgelkkekgihrleamlyaidqinkdpdllsnitlgvrildtcsrdtyaleqsltf
    vqaliekdasdvkcangdppiftkpdkisgvigaaassvsimvanilrlfkipqisyast
    apelsdntrydffsrvvppdsyqaqamvdivtalgwnyvstlasegnygesgveaftqis
    reiggvsiaqsqkipreprpgefekiikrlletpnaravimfaneddirrileaakklnq
    sghflwigsdswgskiapvyqqeeiaegavtilpkrasidgfdryfrsrtlannrrnvwf
    aefweenfgcklgshgkrnshikkctgleriardssyeqegkvqfvidavysmayalhnm
    hkdlcpgyiglcprmstidgkellgyiravnfngsagtpvtfnengdapgrydifqyqit
    nksteykvighwtnqlhlkvedmqwahrenlyfqgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5vA (A:)
    hsirvdgdiilgglfpvhakgergvpcgelkkekgihrleamlyaidqinkdpdllsnit
    lgvrildtcsrdtyaleqsltfvqalipdkisgvigaaassvsimvanilrlfkipqisy
    astapelsdntrydffsrvvppdsyqaqamvdivtalgwnyvstlasegnygesgveaft
    qisreiggvsiaqsqkipreprpgefekiikrlletpnaravimfaneddirrileaakk
    lnqsghflwigsdswgskiapvyqqeeiaegavtilpkrasidgfdryfrsrtlannrrn
    vwfaefweenfgcklctgleriardssyeqegkvqfvidavysmayalhnmhkdlcpgyi
    glcprmstidgkellgyiravnfngsagtpvtfnengdapgrydifqyqitsteykvigh
    wtnqlhlkvedmqwa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e5vB (B:)
    malvcegkrsascpcfflltakfywiltmmrthsqeyahsirvdgdiilgglfpvhakge
    rgvpcgelkkekgihrleamlyaidqinkdpdllsnitlgvrildtcsrdtyaleqsltf
    vqaliekdasdvkcangdppiftkpdkisgvigaaassvsimvanilrlfkipqisyast
    apelsdntrydffsrvvppdsyqaqamvdivtalgwnyvstlasegnygesgveaftqis
    reiggvsiaqsqkipreprpgefekiikrlletpnaravimfaneddirrileaakklnq
    sghflwigsdswgskiapvyqqeeiaegavtilpkrasidgfdryfrsrtlannrrnvwf
    aefweenfgcklgshgkrnshikkctgleriardssyeqegkvqfvidavysmayalhnm
    hkdlcpgyiglcprmstidgkellgyiravnfngsagtpvtfnengdapgrydifqyqit
    nksteykvighwtnqlhlkvedmqwahrenlyfqgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e5vB (B:)
    hsirvdgdiilgglfpvhakgergvpcgelkkekgihrleamlyaidqinkdpdllsnit
    lgvrildtcsrdtyaleqsltfvqaliepdkisgvigaaassvsimvanilrlfkipqis
    yastapelsdntrydffsrvvppdsyqaqamvdivtalgwnyvstlasegnygesgveaf
    tqisrggvsiaqsqkipreprpgefekiikrlletpnaravimfaneddirrileaakkl
    nqsghflwigsdswgskiapvyqqeeiaegavtilpkrasidgfdryfrsrtlannrrnv
    wfaefweenfgcklgshgkrnshikkctgleriardssyeqegkvqfvidavysmayalh
    nmhkdlcpgyiglcprmstidgkellgyiravnfngsagtpvtfnengdapgrydifqyq
    itksteykvighwtnqlhlkvedmqwa